PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 27496.m000094
Common NameLOC8278163, RCOM_0022930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRF
Protein Properties Length: 428aa    MW: 46348.3 Da    PI: 7.1653
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
27496.m000094genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC80.41.6e-25166209144
            WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                    d+epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr+rsrk++e
  27496.m000094 166 DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHVHRGRNRSRKPVE 209
                    79***************************************987 PP

2QLQ53.19.7e-1995130237
            QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                    +F+ aQ+q+L+ Q+l+y+y++a++ +PpeLlq+i+k
  27496.m000094  95 YFSLAQWQELELQALIYRYMLAGAAIPPELLQPIKK 130
                    7*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.6E-1194130IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.6E-1395128IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.84495130IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.918166210IPR014977WRC domain
PfamPF088798.0E-22167209IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MDFHLKQWRN QQHESEEEEE QPSEKMPKLL LDPPHEPQQQ EQQHYPISGS TAAPLPLFVP  60
EPHSNNKNSN LSAFLDSSTA PPATARFPRM GGSGYFSLAQ WQELELQALI YRYMLAGAAI  120
PPELLQPIKK SLLHSPPYFL HHPLQHYSYY QPALLQTGYW GRAAMDPEPG RCRRTDGKKW  180
RCSRDVVAGQ KYCERHVHRG RNRSRKPVEI PTTNSSTSTN TNSTGIGGGG GGGSAGGAIS  240
AAFSSSSPAI VAPLLSGVAS GTSLSFSGHS PSNELLHLNN RSSDPKAEIK GLLLGPQNEV  300
ANRSDGHILR HFFDDWPRSL QEPDNTASNA SPMNSATCLS ISMSGNSSSD VSLKLSTGNG  360
EEPAGSRGSE REHHPQVNWT GGWGTNQMSP MGGPLAEALR SSTSNSSPTS VLHQLPQGST  420
SETIYVST
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1223233TGIGGGGGGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002534110.10.0PREDICTED: growth-regulating factor 3 isoform X1
SwissprotQ8L8A78e-94GRF4_ARATH; Growth-regulating factor 4
TrEMBLB9T7910.0B9T791_RICCO; Putative uncharacterized protein
STRINGVIT_08s0007g03760.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF78953242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.19e-75growth-regulating factor 4